DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and rasl11b

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_956434.1 Gene:rasl11b / 393109 ZFINID:ZDB-GENE-040426-793 Length:244 Species:Danio rerio


Alignment Length:182 Identity:76/182 - (41%)
Similarity:106/182 - (58%) Gaps:24/182 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 CKKSTLTELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCP 72
            |..|.:  :||||||...|||:||:|||||||:||:|:....|.|..|..:|||.|..::.|| |
Zfish    18 CPSSRV--IKIAVIGGSGVGKTALVVRFLTKRFIGDYERNVGNLYSREVQIDGEQVAIQVQDT-P 79

  Fly    73 KAEDEYPNAAEL---------VQWADGLLLVYSITDRKSFNYI-------RRAKSDLQSDTPVQL 121
            ..:   .||..|         :||||.:::|||:||||||:.|       .|..||  ...|:.|
Zfish    80 GVQ---VNANGLSCTDHVSRSIQWADAVVMVYSVTDRKSFDLIGQLHQLVTRTHSD--RSIPIIL 139

  Fly   122 CANKVDMVHLRQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEV 173
            .|||.|::|:|:|...||.:|:....|.|.||||::..:||...|:.||.::
Zfish   140 VANKADLLHVRRVDAQEGPVLSSALSCSFYEVSASEDYNQVHSAFHRLCVDL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 74/174 (43%)
P-loop_NTPase 17..173 CDD:304359 74/171 (43%)
rasl11bNP_956434.1 Small GTPase-like 19..242 75/181 (41%)
small_GTPase 22..187 CDD:197466 72/172 (42%)
RERG_RasL11_like 25..193 CDD:206713 74/173 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 131 1.000 Domainoid score I5114
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4596
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm25211
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2264
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.930

Return to query results.
Submit another query.