DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Ric

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001163165.1 Gene:Ric / 36776 FlyBaseID:FBgn0265605 Length:264 Species:Drosophila melanogaster


Alignment Length:204 Identity:69/204 - (33%)
Similarity:104/204 - (50%) Gaps:41/204 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE-----D 76
            ||.::|...|||||:.::|::..::..:|...|:.|:.:|::|.|..|.:||||..:.|     |
  Fly    61 KIVILGDGGVGKSAVTLQFVSHSFLDYHDPTIEDSYQQQAVIDNEAALLDILDTAGQVEFTAMRD 125

  Fly    77 EYPNAAELVQWADGLLLVYSITDRKSF-------NYIRRAKSDLQSDTPVQLCANKVDMVHLRQV 134
            :|....|      |.::.||:|||.||       ..|.|.:  |..|.|:.|.|||||:...|:|
  Fly   126 QYMRCGE------GFIICYSVTDRHSFQEASEYRKLITRVR--LSEDIPLVLIANKVDLESQRRV 182

  Fly   135 SRDEGEILAKDFECKFSEVSAA--DHVDQVAEVFNELCKEVLASKRKSKQSLLERMLGGARPYSR 197
            :.:||..||..|.|.|.|.|||  .::|   |.|..|.:|:   :||.    :.:.||       
  Fly   183 TTEEGRNLANQFGCPFFETSAALRHYID---EAFYTLVREI---RRKE----MHKALG------- 230

  Fly   198 GKSDSNLPK 206
              :|||..|
  Fly   231 --TDSNSEK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 60/169 (36%)
P-loop_NTPase 17..173 CDD:304359 60/169 (36%)
RicNP_001163165.1 Rit_Rin_Ric 58..229 CDD:206712 63/185 (34%)
small_GTPase 58..223 CDD:197466 61/175 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.