DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and CG5160

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001188708.1 Gene:CG5160 / 34015 FlyBaseID:FBgn0031906 Length:328 Species:Drosophila melanogaster


Alignment Length:204 Identity:70/204 - (34%)
Similarity:107/204 - (52%) Gaps:30/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KSTLTE----------LKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVL 64
            ||:|.:          ||:.|:|...|||:|::|||:|:|:|||||...|..|..:..:|.|.:.
  Fly     7 KSSLVKLGLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRFIGEYDPNLEKIYTCQTTLDKEQIQ 71

  Fly    65 FEILDTCPKAED-EYPNAAELVQWADGLLLVYSITDRKSF----------NYIRR------AKSD 112
            |:|||...:.:: :..:....::|||..:|:|||||:.||          ||.:|      |..:
  Fly    72 FDILDATGQLQELDGVSLESNIRWADAFILMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKE 136

  Fly   113 LQSDTPVQLCANKVDMVHLRQVSRDEGEILAKDFECK-FSEVSAADHVDQVAEVFNELCK--EVL 174
            ...|.||.|..||.|....|.||.:||:...::..|. |.|:|..:.||||..||.::.:  .|.
  Fly   137 YALDIPVILVGNKTDQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFRFWRVF 201

  Fly   175 ASKRKSKQS 183
            :...|.|:|
  Fly   202 SKFPKLKRS 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 63/188 (34%)
P-loop_NTPase 17..173 CDD:304359 62/175 (35%)
CG5160NP_001188708.1 small_GTPase 21..196 CDD:197466 63/174 (36%)
RERG_RasL11_like 24..200 CDD:206713 62/175 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452974
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2554
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108288at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106704
Panther 1 1.100 - - P PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.700

Return to query results.
Submit another query.