DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and zgc:110699

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001018642.1 Gene:zgc:110699 / 325371 ZFINID:ZDB-GENE-050522-487 Length:211 Species:Danio rerio


Alignment Length:190 Identity:74/190 - (38%)
Similarity:104/190 - (54%) Gaps:19/190 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYPNA 81
            |:.|:|..:.||:||.|||:|:|:||||:|:.|..|:.:.:||.|.:..|||||..|  |....|
Zfish    12 KLVVLGRDNCGKTALCVRFITRRFIGEYEHKREVNYRCQKIVDKEAIELEILDTVNK--DCVGAA 74

  Fly    82 A----ELVQWADGLLLVYSITDRKSFNYIRRAKS--DLQSDT---PVQLCANKVDMVHLRQVSRD 137
            |    ..::|.||.|::||:|||.||..:.|.|.  |....|   |..:.|||.||.:.|.|..|
Zfish    75 ASSLESSIKWGDGFLIMYSVTDRSSFEAVSRLKRLIDHVKQTLGIPTVVVANKCDMENGRVVRTD 139

  Fly   138 EGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEV--------LASKRKSKQSLLERML 189
            ||:.||.|..|.|.|:|.|:....|...|.:|.:||        ||..::|:...:...|
Zfish   140 EGQALASDLRCSFFELSVAEDASSVEAAFGQLVREVRQEFQRHLLAMDKRSRMLQMRHAL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 68/164 (41%)
P-loop_NTPase 17..173 CDD:304359 68/164 (41%)
zgc:110699NP_001018642.1 RAS 12..177 CDD:214541 70/166 (42%)
RERG_RasL11_like 12..177 CDD:206713 70/166 (42%)
AAT_I <157..203 CDD:302748 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50142
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_106704
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.730

Return to query results.
Submit another query.