DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rasl11b

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001002830.1 Gene:Rasl11b / 305302 RGDID:1303099 Length:247 Species:Rattus norvegicus


Alignment Length:191 Identity:70/191 - (36%)
Similarity:109/191 - (57%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE----- 75
            :||||:||..|||:||:|||||||:||:|:....|.|..:..::||.:..::.|| |..:     
  Rat    33 VKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLYTRQVHIEGETLAIQVQDT-PGIQVHENG 96

  Fly    76 ---DEYPNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDLQ-----SDTPVQLCANKVDMVHLR 132
               :|..|  ..::|||.:::|:||||.||:..|.:....:|     :..||.:.|||.|::|::
  Rat    97 LSCNEQLN--RCIRWADAVVIVFSITDHKSYELISQLHQHVQQLHPGTRLPVVVVANKADLLHVK 159

  Fly   133 QVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKR------KSKQSLLER 187
            ||....|..||....|.|.|||.:::.:.|...|:.|||||...::      |.:.||:.|
  Rat   160 QVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSPKQQASGTPEKRRTSLIPR 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 64/169 (38%)
P-loop_NTPase 17..173 CDD:304359 64/168 (38%)
Rasl11bNP_001002830.1 Small GTPase-like 28..245 70/191 (37%)
RERG_RasL11_like 34..201 CDD:206713 65/169 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..229 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2264
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.