DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rit2

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001013078.1 Gene:Rit2 / 291713 RGDID:1307654 Length:217 Species:Rattus norvegicus


Alignment Length:185 Identity:63/185 - (34%)
Similarity:102/185 - (55%) Gaps:19/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE---- 75
            |.|:.::||..|||||:.::|::.::...:|...|:.||.:..:|.||...:||||..:||    
  Rat    20 EYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAM 84

  Fly    76 -DEYPNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDL-----QSDTPVQLCANKVDMVHLRQV 134
             ::|....|      |.::.||:|||:||....:.|..:     ..:.|:.|..||:|:...|||
  Rat    85 REQYMRGGE------GFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQV 143

  Fly   135 SRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERML 189
            |.:||..||:|:.|.|.|.|||.... :.:.|..|.:|:  .:::|..||:||.|
  Rat   144 STEEGMTLARDYNCAFFETSAALRFG-IDDAFQGLVREI--RRKESMLSLVERKL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 56/167 (34%)
P-loop_NTPase 17..173 CDD:304359 55/165 (33%)
Rit2NP_001013078.1 Rit_Rin_Ric 19..190 CDD:206712 58/178 (33%)
small_GTPase 19..184 CDD:197466 57/172 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.