DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rit2

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_033091.1 Gene:Rit2 / 19762 MGIID:108054 Length:217 Species:Mus musculus


Alignment Length:185 Identity:63/185 - (34%)
Similarity:102/185 - (55%) Gaps:19/185 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE---- 75
            |.|:.::||..|||||:.::|::.::...:|...|:.||.:..:|.||...:||||..:||    
Mouse    20 EYKVVMLGAGGVGKSAVTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAM 84

  Fly    76 -DEYPNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDL-----QSDTPVQLCANKVDMVHLRQV 134
             ::|....|      |.::.||:|||:||....:.|..:     ..:.|:.|..||:|:...|||
Mouse    85 REQYMRGGE------GFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQV 143

  Fly   135 SRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERML 189
            |.:||..||:|:.|.|.|.|||.... :.:.|..|.:|:  .:::|..||:||.|
Mouse   144 STEEGMNLARDYNCAFFETSAALRFG-IDDAFQGLVREI--RRKESMLSLVERKL 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 56/167 (34%)
P-loop_NTPase 17..173 CDD:304359 55/165 (33%)
Rit2NP_033091.1 Rit_Rin_Ric 19..190 CDD:206712 58/178 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.