DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and W04C9.5

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_490735.3 Gene:W04C9.5 / 189184 WormBaseID:WBGene00021027 Length:369 Species:Caenorhabditis elegans


Alignment Length:205 Identity:55/205 - (26%)
Similarity:92/205 - (44%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 IAVIGAPSVGKSAL---IVRFLTKRYIGEYDHQ----------TENRYKHEAMVDGEPVLFEILD 69
            :.|.|:.:.||..|   |.:|.| |.:.:|:::          |.|...:...::.|.:|...|:
 Worm   173 LRVYGSRNSGKKTLLSAINQFAT-RLVTQYNNESNEGDDTSSKTMNFLLNNEQIELEMLLEATLE 236

  Fly    70 TCPKAEDEYPNAAELVQWADGLLLVYSITDRKSFNYIRRAKSDLQS---------DTPVQLCANK 125
            ..       |.|:.|..:|    :||::.:|:||    ...:||.|         ...:.|..||
 Worm   237 NS-------PFASSLTMYA----IVYNVDNRESF----VCATDLLSRLLNRKIARGANIILIGNK 286

  Fly   126 VDMVHLRQVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSKQSLLERMLG 190
            :|:.....||:.||..|||..:|.|.||| |.:...::|::..:.|::.|.|.:     ||...|
 Worm   287 IDLKRNTVVSKMEGACLAKVHKCNFVEVS-AQYSMNISELWTIILKQLQAPKAE-----LEEPNG 345

  Fly   191 GA-RPYSRGK 199
            .. |..:|||
 Worm   346 WMHRIVTRGK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 46/176 (26%)
P-loop_NTPase 17..173 CDD:304359 46/176 (26%)
W04C9.5NP_490735.3 P-loop_NTPase 171..333 CDD:304359 46/176 (26%)
Ras 177..333 CDD:278499 45/172 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.