DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and Rheb

DIOPT Version :10

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_730950.2 Gene:Rheb / 117332 FlyBaseID:FBgn0041191 Length:182 Species:Drosophila melanogaster


Alignment Length:166 Identity:55/166 - (33%)
Similarity:90/166 - (54%) Gaps:19/166 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEY- 78
            |..||::|..|||||:|.::|:..:::..||...||.:.....|..:..:.:::||.  .:||| 
  Fly     5 ERHIAMMGYRSVGKSSLCIQFVEGQFVDSYDPTIENTFTKIERVKSQDYIVKLIDTA--GQDEYS 67

  Fly    79 --PNAAELVQWA---DGLLLVYSITDRKSFNYIRRAKSDL-----QSDTPVQLCANKVDMVHLRQ 133
              |     ||::   .|.:||||||.:|||..::.....|     :...||.|..||:|:...|.
  Fly    68 IFP-----VQYSMDYHGYVLVYSITSQKSFEVVKIIYEKLLDVMGKKYVPVVLVGNKIDLHQERT 127

  Fly   134 VSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNEL 169
            ||.:||:.||:.:...|.|.||..: :.|.::|::|
  Fly   128 VSTEEGKKLAESWRAAFLETSAKQN-ESVGDIFHQL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 P-loop containing Nucleoside Triphosphate Hydrolases 17..173 CDD:476819 54/164 (33%)
RhebNP_730950.2 RheB 5..182 CDD:206709 55/166 (33%)

Return to query results.
Submit another query.