DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and rerg

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001314766.1 Gene:rerg / 101882104 ZFINID:ZDB-GENE-131018-1 Length:203 Species:Danio rerio


Alignment Length:182 Identity:84/182 - (46%)
Similarity:107/182 - (58%) Gaps:13/182 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYP 79
            |:|:||.|...||||||:|||||||:|.|||...|:.|:|:|.:|.|||..|||||..: ||...
Zfish     6 EVKLAVFGRAGVGKSALVVRFLTKRFIWEYDPTLESTYRHQANIDDEPVSMEILDTAGQ-EDVLQ 69

  Fly    80 NAAELVQWADGLLLVYSITDRKSFNYIRRAKSDLQ-----SDTPVQLCANKVDMVHLRQVSRDEG 139
            ..:.: :|.||.:|||.||||.||..:...|..|:     ...|:.|..||.|:.|.|||...||
Zfish    70 RESHM-RWGDGFILVYDITDRGSFEDVAPLKGLLEDLKRPKHVPLVLLGNKADLEHARQVGTAEG 133

  Fly   140 EILAKDFECKFSEVSA-ADHVDQ---VAEVFNELCKEVLASKRKSKQSLLER 187
            |.||.|..|.|.|.|| :|.|..   |||.|.|||:|:  .:|::.|....|
Zfish   134 ERLAADMACAFYECSACSDAVGSGGGVAEAFYELCREI--RRRRAVQGKTRR 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 80/166 (48%)
P-loop_NTPase 17..173 CDD:304359 79/164 (48%)
rergNP_001314766.1 small_GTPase 5..174 CDD:197466 81/171 (47%)
RERG_RasL11_like 8..173 CDD:206713 80/168 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG50142
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.