DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and rergl

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_017947954.1 Gene:rergl / 100491594 XenbaseID:XB-GENE-6037390 Length:235 Species:Xenopus tropicalis


Alignment Length:205 Identity:84/205 - (40%)
Similarity:119/205 - (58%) Gaps:22/205 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ELKIAVIGAPSVGKSALIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAEDEYP 79
            |..|.|:||..||||||.|||||:|:||||. :.|:.|.|...|||:.|:|.|.| .|.|:|...
 Frog    35 EANILVLGADGVGKSALTVRFLTRRFIGEYG-ELESIYSHNVCVDGKEVIFNIWD-FPYAKDPTE 97

  Fly    80 NAA----ELVQWADGLLLVYSITDRKSFN-------YIRRAKSDLQSD-TPVQLCANKVDMVHLR 132
            .:.    :.:|||||.:|||||.||.|||       .|:.||..|.:: .|:.:..||.|:.|||
 Frog    98 ESCAEEEKRMQWADGYVLVYSICDRASFNVMCQTIQLIKTAKDCLGAEKLPIVIVGNKRDLHHLR 162

  Fly   133 QVSRDEGEILAKDFECKFSEVSAADHVDQVAEVFNELCKEVLASKRKSK-----QSLLERMLGGA 192
            .||.:||.:||...:|.|.|||||:....|..||:.|..::..||..:|     :.:::.|   :
 Frog   163 AVSSEEGRLLALSMDCDFYEVSAAEAYHGVLMVFHGLVDKIRESKLVTKKGTGIRGIVKSM---S 224

  Fly   193 RPYSRGKSDS 202
            ..::|.::||
 Frog   225 AVFARRRTDS 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 77/169 (46%)
P-loop_NTPase 17..173 CDD:304359 76/167 (46%)
rerglXP_017947954.1 P-loop_NTPase 37..205 CDD:393306 76/169 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1384728at2759
OrthoFinder 1 1.000 - - FOG0004892
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45704
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.