DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8519 and rit1

DIOPT Version :9

Sequence 1:NP_648054.2 Gene:CG8519 / 38745 FlyBaseID:FBgn0035711 Length:207 Species:Drosophila melanogaster
Sequence 2:XP_031747350.1 Gene:rit1 / 100486360 XenbaseID:XB-GENE-5777077 Length:183 Species:Xenopus tropicalis


Alignment Length:194 Identity:71/194 - (36%)
Similarity:106/194 - (54%) Gaps:35/194 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LIVRFLTKRYIGEYDHQTENRYKHEAMVDGEPVLFEILDTCPKAE-----DEYPNAAELVQWADG 90
            :.::|::.|:..::|...|:.||....:|.||...:||||..:||     |:|..|.|      |
 Frog     1 MTMQFISHRFPEDHDPTIEDAYKMRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGE------G 59

  Fly    91 LLLVYSITDRKSFNYIRRAKSDL-----QSDTPVQLCANKVDMVHLRQVSRDEGEILAKDFECKF 150
            .::.||||||:||:..|..|..:     ..||||.|..||.|:..|||||::||..||::|.|.|
 Frog    60 FIICYSITDRRSFHEARDFKQLIYRVRRTDDTPVVLVGNKSDLSRLRQVSKEEGSSLAREFNCPF 124

  Fly   151 SEVSAA--DHVDQVAEVFNELCKEV--------LASKRKSK--QSLLERMLGGARPYSRGKSDS 202
            .|.|||  .::|   :||:.|.:|:        ||::||.|  .:|.:|:   ..|:.| |.||
 Frog   125 FETSAAFRYYID---DVFHALVREIRRKEREAALANERKLKPRATLWKRL---KSPFRR-KKDS 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8519NP_648054.2 small_GTPase 14..173 CDD:197466 58/153 (38%)
P-loop_NTPase 17..173 CDD:304359 58/153 (38%)
rit1XP_031747350.1 P-loop_NTPase 1..155 CDD:422963 59/162 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D563049at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.