DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SP1173 and MFSD6L

DIOPT Version :9

Sequence 1:NP_648053.1 Gene:SP1173 / 38744 FlyBaseID:FBgn0035710 Length:741 Species:Drosophila melanogaster
Sequence 2:NP_689812.3 Gene:MFSD6L / 162387 HGNCID:26656 Length:586 Species:Homo sapiens


Alignment Length:283 Identity:49/283 - (17%)
Similarity:90/283 - (31%) Gaps:111/283 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 YVW-------GAIGYVVLFSPLDLFFFQNEPNHDAALVALIIFIVSFVLGAVVLLCATQMPLSPP 469
            :||       |..|...|...||.|...:.|.      .::.|....|:..:.||.:...|:...
Human   288 WVWRLLGMSAGVCGITALVGQLDCFLMTSGPR------GVVHFYGYSVVSTLALLVSIAFPIPIC 346

  Fly   470 EWWWHTKTGMLVVPMSAIRRYTPEILVLTLVSILFGTFWSSIHSYLWWTFTD------------- 521
            :.|   :.....|...:|....|.:::|...::|.|...|::.::|:|...|             
Human   347 QQW---EPSYKRVKALSIVGGDPHLILLASTTVLVGAIVSTVQNFLFWHMKDHGSGELVMGFSVA 408

  Fly   522 ---------------------------VDAVCYSGLIL---------------IL------VLFF 538
                                       :...|.:|.:|               ||      .|::
Human   409 LSLLGEILLHPFKATLLRKLSRTGLVGLGLSCLAGQLLYYSFLWSWWSVLPIQILSAISNRALWW 473

  Fly   539 NVDKFIE--------------YCGH-------SNIFIGGLAIFVIRFTALSDAQTKWLTVIMETI 582
            .|...:|              :.||       ...|:||..  |:||:         |.|:.:..
Human   474 AVGASVEDLATPRMERALSALFRGHFYGSGCSLGSFVGGFV--VMRFS---------LAVLYQAC 527

  Fly   583 EPAVIGLIWITIILYMRHAMPRK 605
              .|..|:|:.::|.::..:||:
Human   528 --CVALLLWLALLLSIQRRLPRE 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SP1173NP_648053.1 MFS 15..88 CDD:304372
Chromate_transp <552..632 CDD:302665 14/54 (26%)
MFSD6LNP_689812.3 MFS <28..87 CDD:304372
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..160
MFS 368..>529 CDD:119392 25/173 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157828
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3762
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR16172
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.