DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eIF4E3

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_174252.2 Gene:eIF4E3 / 839836 AraportID:AT1G29590 Length:240 Species:Arabidopsis thaliana


Alignment Length:202 Identity:68/202 - (33%)
Similarity:110/202 - (54%) Gaps:14/202 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TTQQTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDR 67
            ||..:..:...:..:.::....:.|::.|..:.   :|..|.|   :..|..:|:||.|: :|..
plant    22 TTSPSPIEKHVSAIKAISGDEKAPSKEKKNYAS---KKSTTVI---QKSHCFQNSWTFWF-DNPS 79

  Fly    68 SKN----WEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRW 128
            ||:    |......:.:|..:|:||||||:|..|::...|||...||..|:|.|||.....||:|
plant    80 SKSNQVIWGSSLRSLYTFATIEEFWSLYNNIHPPTKWVSGSDLYCFKDKIEPKWEDPICANGGKW 144

  Fly   129 VINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWTANGHNELAVMEIG 193
            .:...|   |.|:..||:.||.|:||.|:..:|:||||:|.|.:.::||:||....||.|.:.||
plant   145 TMFFPR---ATLESNWLNTLLALVGEQFDQGDEICGAVLNFRTRGDRISLWTKKAANEEAQLSIG 206

  Fly   194 LKLRDLL 200
            .:.::||
plant   207 KQWKELL 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 60/149 (40%)
eIF4E3NP_174252.2 IF4E 67..221 CDD:366742 60/151 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm1042
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.