DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4ea

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_571808.1 Gene:eif4ea / 79380 ZFINID:ZDB-GENE-040413-1 Length:215 Species:Danio rerio


Alignment Length:211 Identity:95/211 - (45%)
Similarity:140/211 - (66%) Gaps:9/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRSKNWEDMQNEITSFDMVED 86
            :||:|.|     .:.:..:.:..:.|. :||||:|.|.||:.:||:||.|:.....|:.||.|||
Zfish    11 NPSNSEE-----KNEENEQQIVSLEDY-IKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVED 69

  Fly    87 FWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGS-KAELDKLWLDVLLI 150
            ||:|||||:..|.:..|.||||||.||:|||||:.||.||||:|.:.:.. :|:||:.||:.||.
Zfish    70 FWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLSKQQRRADLDRFWLETLLC 134

  Fly   151 LIGEAF-ENTEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLRDLLVLPPHQ-LQYQLHK 213
            |:|||| :::::|||||:|:|.|.:||:|||.:..|:.|::.||...::.|.:||.. :.||.|.
Zfish   135 LVGEAFDDHSDDVCGAVVNIRTKGDKIAIWTTDYENKDAIVHIGRVYKERLGVPPKVIIGYQSHA 199

  Fly   214 DTMCKQGSVIKAVYCV 229
            ||..|.||..|..:.|
Zfish   200 DTATKSGSTTKNKFVV 215

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 76/155 (49%)
eif4eaNP_571808.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/16 (25%)
IF4E 39..195 CDD:279921 76/155 (49%)