DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4e2

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001016076.1 Gene:eif4e2 / 548830 XenbaseID:XB-GENE-5823950 Length:212 Species:Xenopus tropicalis


Alignment Length:200 Identity:71/200 - (35%)
Similarity:118/200 - (59%) Gaps:12/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SSSEDLKTLSDMDIRK--PVTEIVDLRLKHPLENTWTLWYLENDRSK-----NWEDMQNEITSFD 82
            |..|||.|..| |..|  .|.|::....:|||:..:|.||.....|:     |:|....:..:..
 Frog     4 SGQEDLTTAED-DFTKSQKVKEVMVPPGEHPLQYKYTFWYSRRTPSRPASTHNYEQNIRQFGTVA 67

  Fly    83 MVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSKAELDKLWLDV 147
            .||.||.:|:||.:|.::...||:.|||.||:|||||:|||.||:|:|.:.:|..:   :.|.::
 Frog    68 SVEQFWRIYSHIVRPGDLTGYSDFHLFKDGIKPMWEDEANKNGGKWIIRLRKGLAS---RFWENI 129

  Fly   148 LLILIGEAFENTEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLRDLLVLPPHQ-LQYQL 211
            :|.::||.|...||:||.|:::|.:.:.:|||....:::.:.:.|...||.:|.|||:. ::|:.
 Frog   130 ILAMLGEQFMVGEEICGVVVSIRFQEDILSIWNKTANDQFSTVRIRDTLRRVLNLPPNTIMEYKT 194

  Fly   212 HKDTM 216
            |.|::
 Frog   195 HTDSL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 55/158 (35%)
eif4e2NP_001016076.1 IF4E 33..192 CDD:396291 57/161 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.