DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4e3

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001016049.1 Gene:eif4e3 / 548803 XenbaseID:XB-GENE-992071 Length:218 Species:Xenopus tropicalis


Alignment Length:188 Identity:51/188 - (27%)
Similarity:88/188 - (46%) Gaps:35/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RKPVTEIVDLRLKHPLENTWTLWYLENDRS------KNWEDMQNEITSFDMVEDFWSLYNHIKQP 97
            ::|.||.:      ||.:.||.|.   |||      ...|....:|.:...::.|||:||:|.|.
 Frog    34 QEPDTEGI------PLHSPWTFWL---DRSLPGTTAAECESNLKKIYTVHTIQSFWSVYNNIPQV 89

  Fly    98 SEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFEN---- 158
            :.:.:...|.|.:...:|:||:::|..||.|.:.:   .|.....:|.::||..|||.|.:    
 Frog    90 TNLPLRWSYHLMRGERKPLWEEESNAKGGVWKMKV---PKEASSLVWKELLLATIGEQFTDRCAP 151

  Fly   159 TEEVCGAVINLRGKSNKISIWTANGH--NELAVMEIGLKLRDLL--------VLPPHQ 206
            .:||.|..:::|.:.:.:.:|..|..  .|..|:|   |:.:||        ...||:
 Frog   152 EDEVIGVSVSVRDREDVVQVWNGNASVVGEATVLE---KIYELLPNTSFKAVFYKPHE 206

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 46/171 (27%)
eif4e3NP_001016049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
IF4E 45..198 CDD:279921 44/161 (27%)