DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4e

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001015909.1 Gene:eif4e / 548663 XenbaseID:XB-GENE-855435 Length:214 Species:Xenopus tropicalis


Alignment Length:211 Identity:98/211 - (46%)
Similarity:135/211 - (63%) Gaps:9/211 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRSKNWEDMQNEITSFDMVED 86
            :|.|:.|: ||.:..:|..|     |..:||||:|.|.||:.:||:||.|:.....|:.||.|||
 Frog    10 NPQSTEEE-KTETSQEIVSP-----DQYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVED 68

  Fly    87 FWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSKA-ELDKLWLDVLLI 150
            ||:|||||:..|.:..|.||||||.||:|||||:.||.||||:|.:.:..:. :||:.||:.|:.
 Frog    69 FWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMC 133

  Fly   151 LIGEAF-ENTEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLRDLLVLPPH-QLQYQLHK 213
            ||||:| |.:::|||||:|:|.|.:||:|||....|..||..||...::.|.||.. .:.||.|.
 Frog   134 LIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVVIGYQSHA 198

  Fly   214 DTMCKQGSVIKAVYCV 229
            ||..|.||..|..:.|
 Frog   199 DTATKSGSTTKNRFVV 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 76/155 (49%)
eif4eNP_001015909.1 IF4E 38..194 CDD:279921 76/155 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3317
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 212 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9344
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.