DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4e2

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001014815.2 Gene:eif4e2 / 541523 ZFINID:ZDB-GENE-050327-59 Length:236 Species:Danio rerio


Alignment Length:223 Identity:76/223 - (34%)
Similarity:126/223 - (56%) Gaps:21/223 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MDNGTETLADSPS-------SSSED-LKTLSDMDIRKPVT----EIVDLRLKHPLENTWTLWYLE 64
            |:|..:.|.|..|       ||.:| .|..:|.:.::..|    .:|....:|||:..:|.||..
Zfish     1 MNNKFDALKDDDSGDHDQDNSSPKDGEKEKNDEEDKEANTTKRKAVVPGAGEHPLQYNYTFWYSR 65

  Fly    65 ND-----RSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKF 124
            ..     .::::|....:|.||..||.||..|:|:.:|.::...||:.|||:||:|||||||||.
Zfish    66 RTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKS 130

  Fly   125 GGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWTANGHNELAV 189
            ||:|:|.:.:|..:   :.|.:::|.::||.|...||:||||:::|.:.:.||||.....::...
Zfish   131 GGKWIIRLRKGLAS---RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATT 192

  Fly   190 MEIGLKLRDLLVLPPHQ-LQYQLHKDTM 216
            ..|...||.:|.|||:. ::|:.|.|::
Zfish   193 ARIRDTLRRVLNLPPNTIMEYKTHTDSI 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 58/158 (37%)
eif4e2NP_001014815.2 IF4E 54..212 CDD:307672 60/160 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.