DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4e3

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001004589.1 Gene:eif4e3 / 447850 ZFINID:ZDB-GENE-040912-156 Length:224 Species:Danio rerio


Alignment Length:205 Identity:54/205 - (26%)
Similarity:96/205 - (46%) Gaps:30/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRS------KNWEDMQNEITS 80
            ||.:|:|:...:.:.::.. :|..|:.....||.:.||.|.   |||      ...|....:|.:
Zfish    18 SPVNSTENDIHIDERELEN-ITNHVEDGTSLPLHSPWTFWL---DRSLPGTTAAECESNLKKIYT 78

  Fly    81 FDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSKAELDKLWL 145
            ...|:.|||:||:|...|.:.:...|.|.:...:|:||:::|..||.|.:.:.:.|..   .:|.
Zfish    79 VHTVQSFWSVYNNIPPVSCLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKESTL---AVWK 140

  Fly   146 DVLLILIGEAF----ENTEEVCGAVINLRGKSNKISIWTANGH--NELAVM--------EIGLKL 196
            ::||..|||.|    .:.:||.|..:::|.:.:.:.:|..|..  ||..|:        :|..| 
Zfish   141 ELLLATIGEQFTDYCASEDEVVGVSVSVREREDVVQVWNGNASFANEANVLGRIYELLPQISFK- 204

  Fly   197 RDLLVLPPHQ 206
              .:...||:
Zfish   205 --AVFYKPHE 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 46/171 (27%)
eif4e3NP_001004589.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 2/4 (50%)
IF4E 51..198 CDD:279921 42/152 (28%)