DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eIF4E5

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_648160.2 Gene:eIF4E5 / 38878 FlyBaseID:FBgn0035823 Length:232 Species:Drosophila melanogaster


Alignment Length:184 Identity:114/184 - (61%)
Similarity:150/184 - (81%) Gaps:0/184 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 EIVDLRLKHPLENTWTLWYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSL 108
            ||..:..|||||:.||||||||||:|:|:||.||||..|.||.|||||:.||.|:|:::|.|||:
  Fly    47 EIYQVEYKHPLEHVWTLWYLENDRTKHWKDMLNEITEIDSVETFWSLYHTIKTPAELKIGCDYSV 111

  Fly   109 FKKGIQPMWEDDANKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKS 173
            |||||:|||||:||..||||::.:.:.:|||||::|||:||:::|:.||.::|:||||||:|.||
  Fly   112 FKKGIKPMWEDEANIKGGRWLVTVSKSAKAELDQIWLDILLLMVGQNFEYSDEICGAVINIRNKS 176

  Fly   174 NKISIWTANGHNELAVMEIGLKLRDLLVLPPHQLQYQLHKDTMCKQGSVIKAVY 227
            ||||:|||||.||:|::|||.||:.||.|..|.||||||.|.|.|..|.:|:||
  Fly   177 NKISVWTANGSNEMAILEIGQKLKILLHLQSHSLQYQLHSDAMSKFNSGVKSVY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 95/152 (63%)
eIF4E5NP_648160.2 IF4E 59..212 CDD:279921 95/152 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470291
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X406
1211.800

Return to query results.
Submit another query.