DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and EIF4E3

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001128123.1 Gene:EIF4E3 / 317649 HGNCID:31837 Length:224 Species:Homo sapiens


Alignment Length:184 Identity:50/184 - (27%)
Similarity:90/184 - (48%) Gaps:28/184 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PLENTWTLWYLENDRS------KNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKK 111
            ||.::||.|.   |||      ........:|.:...|:.|||:||:|...:.:.:...|.|.:.
Human    48 PLHSSWTFWL---DRSLPGATAAECASNLKKIYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRG 109

  Fly   112 GIQPMWEDDANKFGGRWVINMGRGSKAELDKLWLDVLLILIGEAFEN----TEEVCGAVINLRGK 172
            ..:|:||:::|..||.|.:.:.:.|.:   .:|.::||..|||.|.:    .:||.|..:::|.:
Human   110 ERRPLWEEESNAKGGVWKMKVPKDSTS---TVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDR 171

  Fly   173 SNKISIWTANGH--NELAVMEIGLKLRDLLVLPPH----QLQYQLHKDTMCKQG 220
            .:.:.:|..|..  .|..|:|   |:.:||   ||    .:.|:.|::....:|
Human   172 EDVVQVWNVNASLVGEATVLE---KIYELL---PHITFKAVFYKPHEEHHAFEG 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 45/168 (27%)
EIF4E3NP_001128123.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
IF4E 48..198 CDD:396291 43/158 (27%)