DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eIF4E7

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_726718.1 Gene:eIF4E7 / 31059 FlyBaseID:FBgn0040368 Length:429 Species:Drosophila melanogaster


Alignment Length:219 Identity:116/219 - (52%)
Similarity:158/219 - (72%) Gaps:9/219 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLR-LKHPLENTWTLWYLENDRSKNWEDMQN 76
            ||..|.|  |.::..:|     |:.|.....|::::. .:|||.|.||||||||||:|:||:|.:
  Fly   218 DNSLEFL--SLNNKCDD-----DLTIAAENAELLEVEDPQHPLNNCWTLWYLENDRNKSWEEMLH 275

  Fly    77 EITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSKAELD 141
            ::||||.||.||||..|||.|||:.:|||||||||||:|||||:||..|||||||:.:.:|..||
  Fly   276 KVTSFDTVEKFWSLITHIKPPSELMLGSDYSLFKKGIRPMWEDEANVNGGRWVINLTKSAKMALD 340

  Fly   142 KLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLRDLLVLPP-H 205
            ..|:|.:|.|||||.::::::||.|:|:||||||||||.|:|.|:..|:|||..||.:|.:.. :
  Fly   341 SFWMDAMLCLIGEACKHSDDLCGVVVNIRGKSNKISIWNADGGNQTTVLEIGRILRKVLRMDNIY 405

  Fly   206 QLQYQLHKDTMCKQGSVIKAVYCV 229
            .|:||||||:..|.||.:|.:|.|
  Fly   406 VLEYQLHKDSKDKLGSTVKRIYTV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 92/153 (60%)
eIF4E7NP_726718.1 IF4E 255..409 CDD:279921 92/153 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470280
Domainoid 1 1.000 143 1.000 Domainoid score I1494
eggNOG 1 0.900 - - E1_COG5053
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 160 1.000 Inparanoid score I1633
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm6577
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
1211.930

Return to query results.
Submit another query.