DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and Eif4e3

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001100082.1 Gene:Eif4e3 / 297481 RGDID:1586185 Length:207 Species:Rattus norvegicus


Alignment Length:218 Identity:58/218 - (26%)
Similarity:102/218 - (46%) Gaps:38/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ADSPSSSSEDL-KTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRS------KNWEDMQNE 77
            |.:|..:||.| |.||.:   :|....:      ||.:.||.|.   |||      ........:
  Rat     6 AAAPPGASEPLGKALSAL---QPEPGSI------PLHSPWTFWL---DRSLPGATAAECASNLKK 58

  Fly    78 ITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSKAELDK 142
            |.:...|:.|||:||:|...:.:.:...|.|.:...:|:||:::|..||.|.:.:.:.|.:   .
  Rat    59 IYTVQTVQIFWSVYNNIPPVTSLPLRCSYHLMRGERRPLWEEESNAKGGVWKMKVPKDSTS---T 120

  Fly   143 LWLDVLLILIGEAFEN----TEEVCGAVINLRGKSNKISIWTANGH--NELAVMEIGLKLRDLLV 201
            :|.::||..|||.|.:    .:|:.|..:::|.:.:.:.:|..|..  .|..|:|   |:..|| 
  Rat   121 VWKELLLATIGEQFTDCAAADDEIIGVSVSVRDREDVVQVWNVNASLVGEATVLE---KIHQLL- 181

  Fly   202 LPPH----QLQYQLHKDTMCKQG 220
              ||    .:.|:.|::....:|
  Rat   182 --PHISFKAVFYKPHEEHHAFEG 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 44/168 (26%)
Eif4e3NP_001100082.1 IF4E 34..181 CDD:279921 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334513
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.