DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and Eif4e2

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_036021474.1 Gene:Eif4e2 / 26987 MGIID:1914440 Length:265 Species:Mus musculus


Alignment Length:224 Identity:74/224 - (33%)
Similarity:123/224 - (54%) Gaps:22/224 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 MDNGTETLADSPS---SSSEDLKTLSDMDIRKPVTE----------IVDLRLKHPLENTWTLWYL 63
            |:|..:.|.|..|   ..:|:..|..|.:..|...:          :|....:|||:..:|.||.
Mouse     1 MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYS 65

  Fly    64 EN-----DRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANK 123
            ..     ..|:::|....:|.:|..||.||..|:|:.:|.::...||:.|||:||:|||||||||
Mouse    66 RRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANK 130

  Fly   124 FGGRWVINMGRGSKAELDKLWLDVLLILIGEAFENTEEVCGAVINLRGKSNKISIWTANGHNELA 188
            .||:|:|.:.:|..:   :.|.:::|.::||.|...||:||||:::|.:.:.||||.....::..
Mouse   131 NGGKWIIRLRKGLAS---RCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQAT 192

  Fly   189 VMEIGLKLRDLLVLPPHQ-LQYQLHKDTM 216
            ...|...||.:|.|||:. ::|:.|.|::
Mouse   193 TARIRDTLRRVLNLPPNTIMEYKTHTDSI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 58/158 (37%)
Eif4e2XP_036021474.1 IF4E 55..214 CDD:396291 60/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830813
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.