DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and tif45

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_594228.1 Gene:tif45 / 2541706 PomBaseID:SPAC16E8.15 Length:218 Species:Schizosaccharomyces pombe


Alignment Length:220 Identity:81/220 - (36%)
Similarity:127/220 - (57%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QTEFKMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYL-ENDRSK 69
            |||....::.||.....|...:  |:|:.|        :.::..|||||...||||:| ......
pombe     2 QTEQPPKESQTENTVSEPQEKA--LRTVFD--------DKINFNLKHPLARPWTLWFLMPPTPGL 56

  Fly    70 NWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVI-NMG 133
            .|.::|..|.:|:.||:||.::|:|...|.:.:.||||.|::|::|.|||..||.||:|.. |.|
pombe    57 EWNELQKNIITFNSVEEFWGIHNNINPASSLPIKSDYSFFREGVRPEWEDVHNKTGGKWAFQNKG 121

  Fly   134 RGSKAELDKLWLDVLLILIGEAFENT-EEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLR 197
            ||..| ||::||..:|..|||..:.| :||.|.|||:|....::::||.:.:|...:||||.:.:
pombe   122 RGGNA-LDEMWLTTVLAAIGETLDPTGQEVMGVVINMRKGFYRLAVWTKSCNNREVLMEIGTRFK 185

  Fly   198 DLLVLPPHQ-LQYQLHKDTMCKQGS 221
            .:|.||..: :::..|:|: .|.||
pombe   186 QVLNLPRSETIEFSAHEDS-SKSGS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 62/156 (40%)
tif45NP_594228.1 CDC33 1..218 CDD:227386 81/220 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 134 1.000 Domainoid score I1275
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I1318
OMA 1 1.010 - - QHG54586
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9263
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.