DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and Eif4e1b

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001273108.1 Gene:Eif4e1b / 218268 MGIID:2685119 Length:250 Species:Mus musculus


Alignment Length:222 Identity:88/222 - (39%)
Similarity:135/222 - (60%) Gaps:18/222 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ETLADSPSSSSED-------------LKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRS 68
            |.:.:.||.::.:             |||......|:...|:  |...|||:..|.||:.:||||
Mouse    25 EVVKEKPSEATAEGVQAGEAKDLPGSLKTQRRKAHREHPPEV--LSKLHPLQYRWVLWFFKNDRS 87

  Fly    69 KNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMG 133
            :.|:|....:|.|:.|||||::|:|||..|::..|.||:|||:||.|||||:.||.||||::::.
Mouse    88 RAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSID 152

  Fly   134 RGSK-AELDKLWLDVLLILIGEAFEN-TEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKL 196
            :..: .|||:|||:.||.|:|..||. :.||||||:|:|.|.:||::||:...::..||:||...
Mouse   153 KQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIY 217

  Fly   197 RDLLVLPPHQ-LQYQLHKDTMCKQGSV 222
            ::.|.:.... :.||.|.||..|..::
Mouse   218 KERLGISTKTIIGYQAHADTAAKSNNL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 70/155 (45%)
Eif4e1bNP_001273108.1 IF4E 75..231 CDD:279921 70/155 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830792
Domainoid 1 1.000 186 1.000 Domainoid score I3337
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3600
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8694
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.