DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and EIF4E

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:NP_001124151.1 Gene:EIF4E / 1977 HGNCID:3287 Length:248 Species:Homo sapiens


Alignment Length:247 Identity:98/247 - (39%)
Similarity:139/247 - (56%) Gaps:39/247 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 ETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRSKNWEDMQNEITSF 81
            ||.......::|:.||.|:.::..|     :..:||||:|.|.||:.:||:||.|:.....|:.|
Human     7 ETTPTPNPPTTEEEKTESNQEVANP-----EHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKF 66

  Fly    82 DMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGS-KAELDKLWL 145
            |.|||||:|||||:..|.:..|.||||||.||:|||||:.||.||||:|.:.:.. :::||:.||
Human    67 DTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWL 131

  Fly   146 DV-------------------------------LLILIGEAFEN-TEEVCGAVINLRGKSNKISI 178
            :.                               ||.||||:|:: :::|||||:|:|.|.:||:|
Human   132 ETRWDLAMLPRLVSNFWPQVILPLQPPKVLELQLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAI 196

  Fly   179 WTANGHNELAVMEIGLKLRDLLVLPPH-QLQYQLHKDTMCKQGSVIKAVYCV 229
            ||....|..||..||...::.|.|||. .:.||.|.||..|.||..|..:.|
Human   197 WTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 77/186 (41%)
EIF4ENP_001124151.1 IF4E 38..228 CDD:366742 79/189 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165140838
Domainoid 1 1.000 187 1.000 Domainoid score I3336
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 214 1.000 Inparanoid score I3630
Isobase 1 0.950 - 0 Normalized mean entropy S964
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8454
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.