DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and Eif4e

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_006501056.1 Gene:Eif4e / 13684 MGIID:95305 Length:230 Species:Mus musculus


Alignment Length:223 Identity:100/223 - (44%)
Similarity:141/223 - (63%) Gaps:8/223 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KMMDNGTETLADSPSSSSEDLKTLSDMDIRKPVTEIVDLRLKHPLENTWTLWYLENDRSKNWEDM 74
            ||.....||...:....:|:.||.|:.::..|     :..:||||:|.|.||:.:||:||.|:..
Mouse    13 KMATVEPETTPTTNPPPAEEEKTESNQEVANP-----EHYIKHPLQNRWALWFFKNDKSKTWQAN 72

  Fly    75 QNEITSFDMVEDFWSLYNHIKQPSEIRVGSDYSLFKKGIQPMWEDDANKFGGRWVINMGRGS-KA 138
            ...|:.||.|||||:|||||:..|.:..|.||||||.||:|||||:.||.||||:|.:.:.. ::
Mouse    73 LRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRS 137

  Fly   139 ELDKLWLDVLLILIGEAFEN-TEEVCGAVINLRGKSNKISIWTANGHNELAVMEIGLKLRDLLVL 202
            :||:.||:.||.||||:|:: :::|||||:|:|.|.:||:|||....|..||..||...::.|.|
Mouse   138 DLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGL 202

  Fly   203 PPH-QLQYQLHKDTMCKQGSVIKAVYCV 229
            ||. .:.||.|.||..|.||..|..:.|
Mouse   203 PPKIVIGYQSHADTATKSGSTTKNRFVV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 77/155 (50%)
Eif4eXP_006501056.1 IF4E 51..210 CDD:366742 79/158 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830801
Domainoid 1 1.000 186 1.000 Domainoid score I3337
eggNOG 1 0.900 - - E1_COG5053
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H123817
Inparanoid 1 1.050 215 1.000 Inparanoid score I3600
Isobase 1 0.950 - 0 Normalized mean entropy S964
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm8694
orthoMCL 1 0.900 - - OOG6_100627
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1817.750

Return to query results.
Submit another query.