DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4E4 and eif4e1b

DIOPT Version :9

Sequence 1:NP_648052.1 Gene:eIF4E4 / 38743 FlyBaseID:FBgn0035709 Length:229 Species:Drosophila melanogaster
Sequence 2:XP_002936991.4 Gene:eif4e1b / 100127761 XenbaseID:XB-GENE-6258261 Length:217 Species:Xenopus tropicalis


Alignment Length:194 Identity:91/194 - (46%)
Similarity:126/194 - (64%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 RKPVTEIVDLRLKHPLENTWTLWYLENDRSKNWEDMQNEITSFDMVEDFWSLYNHIKQPSEIRVG 103
            :|..:.|::..:||.|::.|.||:.:|.:|:.|:.....:|:|:.||||||||.||:..|::..|
 Frog    24 KKKESVILEKVIKHSLQSRWALWFFKNVKSQPWQCNLRLVTTFNTVEDFWSLYTHIQLASKLSSG 88

  Fly   104 SDYSLFKKGIQPMWEDDANKFGGRWVINMGRGSK-AELDKLWLDVLLILIGEAF-ENTEEVCGAV 166
            .||||||.||:|||||..||.||||:|.:.:..: ::||.|||:.||.|||||| |.:|||||||
 Frog    89 CDYSLFKDGIEPMWEDSRNKRGGRWLITLSKQQRHSDLDALWLETLLCLIGEAFDEYSEEVCGAV 153

  Fly   167 INLRGKSNKISIWTANGHNELAVMEIGLKLRDLLVLPPH-QLQYQLHKDTMCKQGSVIKAVYCV 229
            ||:|.|.:||:|||....|..||..||...::.|.|... .:.||.|.||..|..|:.|..:.|
 Frog   154 INIRAKGDKIAIWTRETENREAVTHIGKVYKERLGLSSKVVIGYQAHADTATKSSSLSKNKFVV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4E4NP_648052.1 IF4E 56..209 CDD:279921 77/155 (50%)
eif4e1bXP_002936991.4 IF4E 39..197 CDD:396291 78/157 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 185 1.000 Domainoid score I3317
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 212 1.000 Inparanoid score I3552
OMA 1 1.010 - - QHG54586
OrthoDB 1 1.010 - - D1394271at2759
OrthoFinder 1 1.000 - - FOG0000666
OrthoInspector 1 1.000 - - mtm9344
Panther 1 1.100 - - O PTHR11960
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R595
SonicParanoid 1 1.000 - - X406
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.