DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIA and Ir7f

DIOPT Version :9

Sequence 1:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster


Alignment Length:461 Identity:76/461 - (16%)
Similarity:159/461 - (34%) Gaps:136/461 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   507 RFEGYCKDLADMLAAQLGIKYE---IRLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMT 568
            |..|:...|.:.||.::....|   |.|::...|    :.|.|..:|.:.:|:::..:|::....
  Fly   252 RGSGFEIQLVEHLARRMNFSLELVNIALLRPNAY----RLAEGSSEGPIEKLLQRNVNISMGYFR 312

  Fly   569 ITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIWISVILS---YVGVSFVLYF 630
            .||.|.:::.....:.:..:..:::....:...:...:.|....:|:.::|:   ::|:..    
  Fly   313 KTARRNQLLTTPMSYYSANLVAVLQLERYRIGSLALLVFPFELSVWMLLLLALLIHLGIHL---- 373

  Fly   631 VTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQG 695
                          |.|....::..|  ||..:                        :|..:...
  Fly   374 --------------PSARRGNEEDGG--GGLQV------------------------VALLLGAA 398

  Fly   696 CDITPPSIAGRIAAAVWWFFTIILISSYTA-----------NLAAFLTVERMVAP---------- 739
            ....|.|...|..||.|.:.:|.|..||.:           |..:| ::::::|.          
  Fly   399 LARLPRSWRHRFIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSF-SLDQLLAEGFQGICTANT 462

  Fly   740 ----IKTPE-----DLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQ-------HHS 788
                ::.|:     |.....|..:       .|:.........:.|:  :..|||       |.|
  Fly   463 QRLLLEMPQLARDPDSIQSVDTPF-------DWDVLNVLTRNRNRKI--FAVANQDVTLSFLHSS 518

  Fly   789 VHTYDEGIRRVRQSKG-KYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRL 852
            .|  ......|:|... :||.:. .||:.::..:...|.    |.:|..||..|.       :|.
  Fly   519 AH--PNAFHVVKQPVNVEYAGMY-MPKHSFLYEKMDDDI----RRLDASGFIHAW-------RRA 569

  Fly   853 NEAVLTLKENGELLRIRNKWWFDKTECNLDQETSTPNELSLSNVAGIYYILIGGLLLAVIVAIME 917
            :.|.:..||...:                    ::...::.:.::|||.::.|..|||.::...|
  Fly   570 SFASVHRKEQVHM--------------------TSRRYINHAKLSGIYMVMAGLYLLAGLLFAGE 614

  Fly   918 FFCRNK 923
            ...|.:
  Fly   615 VLLRQR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 67/415 (16%)
Lig_chan 612..907 CDD:278489 53/335 (16%)
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 18/109 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462564
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.