DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIA and Ir7e

DIOPT Version :9

Sequence 1:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001138176.1 Gene:Ir7e / 7354417 FlyBaseID:FBgn0259189 Length:608 Species:Drosophila melanogaster


Alignment Length:464 Identity:92/464 - (19%)
Similarity:154/464 - (33%) Gaps:125/464 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   489 PYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWDGMVG 553
            |:|:|.: ...|.|..|..:||   .|...||.::.....:|.|.....           |..:.
  Fly   221 PFLTLDE-DQEEVLRVNGGYEG---RLLLALAEKMNFTIAVRKVHVNMR-----------DEALE 270

  Fly   554 ELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFL------------ 606
            .|.|.|.|:.:..:..|..|..|...|..:             .||..||..|            
  Fly   271 MLRRDEVDLTLGGIRQTVARGMVATSSHNY-------------HQTREVFGVLASSYELSSFDIL 322

  Fly   607 -NPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHV 670
             .|...:||:. ||..|.:|.::.                           :|.|..|.|     
  Fly   323 FYPYRLQIWMG-ILGVVALSALIQ---------------------------LIVGRMLRE----- 354

  Fly   671 PPVPPNEFTMLNSFWYSL-AAFMQQGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTVE 734
                    .|.:.||.:| ..|:.......|.|...|:...:...:|:|:.:.|...|...:...
  Fly   355 --------RMGSRFWLNLELVFVGMPLLECPRSHTARLYCVMLMMYTLIIRTIYQGLLYHLIRTH 411

  Fly   735 RMVAPIKTPEDLTMQTDVNYGTLLYGSTWEF-----------FRRSQIGLHNKMWEYMNAN---- 784
            ::....:|.|.|..:   |:..:|.....|.           ||..:.........::.||    
  Fly   412 QLNRWPQTIESLVQK---NFTVVLTPIVQEVLDEIPSVQHMRFRLLEANSELDPLYFLEANHQLR 473

  Fly   785 QHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCD------TMKVGRNIDTKGFGVATP 843
            ||.:....|..|...|.|..|.....|.....:....|. |      ||.:.::           
  Fly   474 QHVTASALDIFIHFNRLSADKVHQRGEQGSGAHFEIVPE-DIISMQLTMYLAKH----------- 526

  Fly   844 IGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTECNLDQETSTPNELSLSNVAGIYYILIGGLL 908
              |.|..:|||.::.::..| ||.:.::|  :.:|..|..|.|. ..|....:..|:.:::.||:
  Fly   527 --SFLIDQLNEEIMWMRSVG-LLSVWSRW--ELSESYLRNEQSF-QVLGTMELYAIFLMVLVGLI 585

  Fly   909 LAVIVAIME 917
            :.::|.|:|
  Fly   586 VGLLVFILE 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 81/424 (19%)
Lig_chan 612..907 CDD:278489 59/316 (19%)
Ir7eNP_001138176.1 PBPb 218..>313 CDD:214497 27/119 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462557
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.