DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIA and Ir76a

DIOPT Version :9

Sequence 1:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster


Alignment Length:184 Identity:39/184 - (21%)
Similarity:69/184 - (37%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 GMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIW 614
            |:||.::.:..|..:..|.:..|....:|.:......|::.::..|.:...... .|.|....:|
  Fly   299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNRLISWTL-LLRPFQFVLW 362

  Fly   615 ISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFT 679
            :.|:|..:..|..|           .|.||.:..|.|      .|.:.:|..:          |.
  Fly   363 MCVMLCLLLESLAL-----------GITRRWEHSSVA------AGNSWISSLR----------FG 400

  Fly   680 MLNSFWYSLAAFMQQGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTV 733
            .::    :|..|:.|..:....|.|.|......:...|||.:.|:..|||.||:
  Fly   401 CIS----TLKLFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 39/184 (21%)
Lig_chan 612..907 CDD:278489 28/122 (23%)
Ir76aNP_001097647.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.