DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIA and Ir68b

DIOPT Version :9

Sequence 1:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:440 Identity:80/440 - (18%)
Similarity:148/440 - (33%) Gaps:106/440 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 RLVQDGNYGAENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKK 594
            |.:.:|||           .|:|.:::......|.::..:.......::...|:....:.:::..
  Fly   247 RCLPNGNY-----------TGVVSDIVGGHTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVVPA 300

  Fly   595 PVKQTPGVFSFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRP--QADSTAQQPPGI 657
            ...| |....|:....:.:|..::::.:.|..|.:.:.|.   :.||.||.  |..:|..:...:
  Fly   301 SAIQ-PEYLIFVRVFRRTVWYLLLVTLLVVVLVFWVMQRL---QRRIPRRGVIQFQATWYEILEM 361

  Fly   658 IGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAAVWWFFTIILISS 722
            .|...:.||...:     :.|:.:.:|                  :.|      |..|:.:|.:.
  Fly   362 FGKTHVGEPAGRL-----SSFSSMRTF------------------LMG------WILFSYVLSTI 397

  Fly   723 YTANLAAFLTVERMVAPIKTPEDLTMQTDVN-YG-TLLYGSTWEFFRRSQIGLHNKMWEYMNANQ 785
            |.|.|.:..........:...:|| :..||: |. |.:|.:........|.||    .|..:...
  Fly   398 YFAKLESGFVRPSYEEQVDRVDDL-VHLDVHIYAVTTMYDAVRSALTEHQYGL----LENRSRQL 457

  Fly   786 HHSVHT--YDEGIRR--------VRQSKGKYALLV----ESPKNEYVNARPPCDTMKVGRNIDTK 836
            ...:.|  |...:||        :|....:..|.:    ::.:..|..||....:|         
  Fly   458 PLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPAYHIAREYLRSM--------- 513

  Fly   837 GFGVAT---PIGSPLRKRLNEAVLTLKENGELLRIRNKWWFDKTECNLDQE------------TS 886
               :.|   |.|||...||........|:|.....|......:...:.|.|            .|
  Fly   514 ---ICTYILPRGSPFLHRLESLYSGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDLGDQTDTDS 575

  Fly   887 TPNELSLSN---------VAGIYYIL---IGGLLLAVIVAIMEFFCRNKT 924
            ..|||::.|         :.|.:|:.   ||...|...|....:|.|.:|
  Fly   576 GSNELAIRNKKVVLTLDILQGAFYLWSVGIGISCLGFAVEHAHWFWRRQT 625

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 64/369 (17%)
Lig_chan 612..907 CDD:278489 64/339 (19%)
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 60/322 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462577
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.