DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GluRIA and Ir7g

DIOPT Version :9

Sequence 1:NP_476855.1 Gene:GluRIA / 38742 FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster
Sequence 2:NP_001368933.1 Gene:Ir7g / 31694 FlyBaseID:FBgn0029968 Length:607 Species:Drosophila melanogaster


Alignment Length:438 Identity:82/438 - (18%)
Similarity:142/438 - (32%) Gaps:133/438 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 GMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIW 614
            |:.|.|::              |..|.::||..|.  |:...:|.....|..  ..|..|.||..
  Fly   236 GLEGRLLQ--------------ELSRRMNFSIQFS--GLQDQLKNRTTWTEK--QLLQKLVQERI 282

  Fly   615 ISVILSYV--GVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNE 677
            ..:.:.||  .:.:.......||.|..|:|                 |..|.  .||       .
  Fly   283 AHLAIGYVRKRIQYATNLTPVFPHYSNRVV-----------------GCLLL--NAH-------N 321

  Fly   678 FTMLN--SF------WYSLA-AFMQQGC--------------------------DITPPSIAG-R 706
            .|.|.  ||      |..|. :|:...|                          .|.||.... :
  Fly   322 LTSLEIWSFPFQALTWICLVFSFLSISCLALLHXRGAGDRLALVLAVYAASLGLPIDPPERPSLQ 386

  Fly   707 IAAAVWWFFTIILISSYTANLAAFLTVERMVAPIKTPEDLTMQTDVNYGTLLYGSTWEFFR---- 767
            :..|.|..|.:|:.|.|:|.|...|   |.....:.|.:|...|..:|..::..:|.:..|    
  Fly   387 LLFASWLIFGLIVRSMYSALLFFIL---RYHLHQRLPGNLQDLTHGDYAAVMGRTTLQDLREVPS 448

  Fly   768 -RSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYAL---LVESPKNEYVNARP------ 822
             :..:||.:.:  ..:..:...:.|.|.  ..:|:..|.:.|   |:......::..|.      
  Fly   449 LQDLLGLKSVI--VTSEREEEVLRTLDR--CTLREGAGSHPLFFGLISQDALLHLTQRGHRAGAY 509

  Fly   823 ---PCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNKW--------WFDK 876
               |.|.::       :...:.....|.|...|:..|::::..|    :.:.|        :|..
  Fly   510 HIIPQDVLE-------QQLAIYLQKHSHLASHLDHLVMSIRSVG----LVHHWAGQMASERYFRS 563

  Fly   877 TECNLDQETSTPNELSLSNVAGIYYILIGGL-LLAVIVAIMEFFCRNK 923
            .....::....|:..::       |||..|| ||:::|.|.|.....:
  Fly   564 RFLYREKRIRQPDLWAV-------YILTAGLYLLSLVVFICELLASRR 604

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375
ANF_receptor 53..434 CDD:279440
PBP2_iGluR_AMPA 477..879 CDD:270433 71/391 (18%)
Lig_chan 612..907 CDD:278489 61/357 (17%)
Ir7gNP_001368933.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.