DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and BTBD6

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001374496.1 Gene:BTBD6 / 90135 HGNCID:19897 Length:538 Species:Homo sapiens


Alignment Length:345 Identity:80/345 - (23%)
Similarity:123/345 - (35%) Gaps:93/345 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 SAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSV---- 181
            |||||:.||....||....                      |..:....||.|.::.||:.    
Human    89 SAPAPAPPPPAPAPPTLGN----------------------NHQESPGWRCCRPTLRERNALMFN 131

  Fly   182 -ELAKLIH---AGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFN 242
             ||...:|   ..|.:.|....|..:|.|..:.|         :.:.|.|      :.|:....:
Human   132 NELMADVHFVVGPPGATRTVPAHKYVLAVGSSVF---------YAMFYGD------LAEVKSEIH 181

  Fly   243 VPDLIIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAA 307
            :||            :..|..|.:.|.::..:   :..:..||:.|              ..||.
Human   182 IPD------------VEPAAFLILLKYMYSDE---IDLEADTVLAT--------------LYAAK 217

  Fly   308 KQL--AAAKASQS-TENGAEGDGA-----QQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQL 364
            |.:  |.|||..: .|...|...|     |..|...|.          |.....::||..||:.|
Human   218 KYIVPALAKACVNFLETSLEAKNACVLLSQSRLFEEPE----------LTQRCWEVIDAQAEMAL 272

  Fly   365 SMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTP 429
            ......::..:.||.:|.|:.|..: |..:||.:..|:.|||.|:.:..||.|:|.|||......
Human   273 RSEGFCEIDRQTLEIIVTREALNTK-EAVVFEAVLNWAEAECKRQGLPITPRNKRHVLGRALYLV 336

  Fly   430 RYLRMTASEFRRCCERLELL 449
            |...||..||.....:.::|
Human   337 RIPTMTLEEFANGAAQSDIL 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 10/65 (15%)
BACK <354..423 CDD:355779 23/68 (34%)
BTBD6NP_001374496.1 BTB_POZ_BTBD6 128..236 CDD:349658 28/151 (19%)
BACK_BTBD6 236..330 CDD:350600 29/104 (28%)
PHR 392..537 CDD:400388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45774
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.