DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and btbd2a

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001038557.1 Gene:btbd2a / 565970 ZFINID:ZDB-GENE-030829-3 Length:595 Species:Danio rerio


Alignment Length:365 Identity:85/365 - (23%)
Similarity:126/365 - (34%) Gaps:112/365 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AIQSAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVE 182
            |..||.|.:|.....:|.:.|.                   ::|..:..|..:..:.:|.||...
Zfish   134 ASSSADASAAAAVSSLPSSPAS-------------------VLVYREPVYNWQATKSTVKERFAF 179

  Fly   183 LAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKI------------- 234
            |.       |:...||.||           |:.:.|....||  .|:..|.:             
Zfish   180 LF-------NNEVLSDVHF-----------LVGKGMGVQRIP--AHRFALAVGSAVFDAMFNGGM 224

  Fly   235 LELSDRFNVPDLIIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQ----TVITTQETGQQL 295
            ...|....:||            :..|..|.:.|.|:       :::.|    ||:||..|    
Zfish   225 ATTSTEIELPD------------VEPAAFLALLKFLY-------SDEVQIGPETVMTTLYT---- 266

  Fly   296 ARKKATKAKAA------AKQLAAAKASQSTENGAEGDGAQQNLIPNPNPFTTEDYGVALLHNTLQ 354
            |:|.|..|..|      .|.|.|..|....        .|..|...|.          |....|:
Zfish   267 AKKYAVPALEAHCVEFLKKNLRADNAFMLL--------TQARLFDEPQ----------LASLCLE 313

  Fly   355 LIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRR 419
            .||.:....|:....:|:..:.|..:::||||.:| ||.||.....|:.||..|:.:..||||:|
Zfish   314 NIDKNTADALAAEGFTDVDLDTLVAVLERDTLGVR-EVRLFGAAVRWAEAEAQRQQLQPTPENKR 377

  Fly   420 TVLGPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITD 459
            .|||......|:..||..||        ...|.:..::||
Zfish   378 RVLGKALALIRFPLMTIEEF--------AAGPAQSGILTD 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 14/78 (18%)
BACK <354..423 CDD:355779 24/68 (35%)
btbd2aNP_001038557.1 BTB 180..284 CDD:279045 30/146 (21%)
BTB 188..287 CDD:197585 28/134 (21%)
BACK 299..398 CDD:197943 35/117 (30%)
PHR 446..593 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.