DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and BTBD2

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_060267.2 Gene:BTBD2 / 55643 HGNCID:15504 Length:525 Species:Homo sapiens


Alignment Length:408 Identity:95/408 - (23%)
Similarity:140/408 - (34%) Gaps:128/408 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 AIQSAPAPSAPPAHMMPP-----AYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVL 177
            |..:||.|: |||   ||     |.|.|.......    ..|  ....:..:..|..:..:.:|.
Human    50 AAAAAPGPT-PPA---PPGPGTDAQAAGAERAEEA----AGP--GAAALQREAAYNWQASKPTVQ 104

  Fly   178 ERSVELAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKI-------- 234
            ||...|.       |:....|.||           |:.:.:....||  .|:.:|.:        
Human   105 ERFAFLF-------NNEVLCDVHF-----------LVGKGLSSQRIP--AHRFVLAVGSAVFDAM 149

  Fly   235 -----LELSDRFNVPDLIIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQ----TVITTQE 290
                 ...|....:||            :..|..|.:.|.|:       :::.|    ||:||..
Human   150 FNGGMATTSTEIELPD------------VEPAAFLALLKFLY-------SDEVQIGPETVMTTLY 195

  Fly   291 TGQQLARKKATKAKAA------AKQLAAAKASQSTENGAEGDGAQQNLIPNPNPFTTEDYGVALL 349
            |    |:|.|..|..|      .|.|.|..|....        .|..|...|.          |.
Human   196 T----AKKYAVPALEAHCVEFLKKNLRADNAFMLL--------TQARLFDEPQ----------LA 238

  Fly   350 HNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDAT 414
            ...|:.||.:....::....:|:..:.|..:::||||.:| ||.||..:..||.|||.|:.:..|
Human   239 SLCLENIDKNTADAITAEGFTDIDLDTLVAVLERDTLGIR-EVRLFNAVVRWSEAECQRQQLQVT 302

  Fly   415 PENRRTVLGPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITDALDGKKLKNLTDQQAELLEK 479
            |||||.|||......|:..||..||        ...|.:..::.|              .|::..
Human   303 PENRRKVLGKALGLIRFPLMTIEEF--------AAGPAQSGILVD--------------REVVSL 345

  Fly   480 F------RQPRAEYARMP 491
            |      .:||.|:...|
Human   346 FLHFTVNPKPRVEFIDRP 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 12/78 (15%)
BACK <354..423 CDD:355779 26/68 (38%)
BTBD2NP_060267.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..86 13/45 (29%)
BTB 110..214 CDD:279045 28/146 (19%)
BTB 118..217 CDD:197585 27/134 (20%)
BACK 229..328 CDD:197943 37/117 (32%)
PHR 376..523 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.