DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and BTBD1

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_079514.1 Gene:BTBD1 / 53339 HGNCID:1120 Length:482 Species:Homo sapiens


Alignment Length:424 Identity:91/424 - (21%)
Similarity:132/424 - (31%) Gaps:147/424 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LGP--DGHHVDAIQSAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRC 171
            |||  .|......::.|.|:.||.   ||:            |..:.|   .:.:..:..|..:.
Human     4 LGPAAAGEQASGAEAEPGPAGPPP---PPS------------PSSLGP---LLPLQREPLYNWQA 50

  Fly   172 ERKSVLERSVELAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILE 236
            .:.|:.||...|.       ||...||..|.:   .|.      |.......|.|...|      
Human    51 TKASLKERFAFLF-------NSELLSDVRFVL---GKG------RGAAAAGGPQRIPAH------ 93

  Fly   237 LSDRFNVPDLIIYCIRELDLRISSATALDIFKALWFYQGIALTNQH------------------- 282
                                |...|....:|.|: |..|:|.|:..                   
Human    94 --------------------RFVLAAGSAVFDAM-FNGGMATTSAEIELPDVEPAAFLALLRFLY 137

  Fly   283 --------QTVITTQETGQQLARKKATKAKAA------AKQLAAAKASQSTENGAEGDGAQQNLI 333
                    :||:||..|    |:|.|..|..|      .|.|.|..|....        .|..|.
Human   138 SDEVQIGPETVMTTLYT----AKKYAVPALEAHCVEFLTKHLRADNAFMLL--------TQARLF 190

  Fly   334 PNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECL 398
            ..|.          |....|..||......:|....:|:..:.|..:::||||.:| |..||..:
Human   191 DEPQ----------LASLCLDTIDKSTMDAISAEGFTDIDIDTLCAVLERDTLSIR-ESRLFGAV 244

  Fly   399 ATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRMTASEFRRCCERLELLPPTEISLITDALDG 463
            ..|:.|||.|:.:..|..|::.|||......|:..||..||        ...|.:..:::|    
Human   245 VRWAEAECQRQQLPVTFGNKQKVLGKALSLIRFPLMTIEEF--------AAGPAQSGILSD---- 297

  Fly   464 KKLKNLTDQQAELLEKF------RQPRAEYARMP 491
                      .|::..|      .:||.||...|
Human   298 ----------REVVNLFLHFTVNPKPRVEYIDRP 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 10/65 (15%)
BACK <354..423 CDD:355779 21/68 (31%)
BTBD1NP_079514.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..36 11/46 (24%)
BTB 62..175 CDD:306997 30/159 (19%)
BACK 187..286 CDD:197943 32/117 (27%)
PHR 334..480 CDD:311801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.