DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and Btbd6

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_964008.2 Gene:Btbd6 / 399566 MGIID:3026623 Length:539 Species:Mus musculus


Alignment Length:340 Identity:79/340 - (23%)
Similarity:124/340 - (36%) Gaps:87/340 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 APAPSAP-PAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVLERSVELAK 185
            ||||..| ||   ||            :|...||...    |....:....||.:::..: ||..
Mouse    93 APAPLPPLPA---PP------------LPDNNNPESP----NWQSFHPTLRERNALMFNN-ELMA 137

  Fly   186 LIH---AGPNSGRKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFNVPDLI 247
            .:|   ....:.|:...|..:|.|..:.|         :.:.|.|      :.|:....::||  
Mouse   138 DVHFIVGALGAARRVPAHKYVLAVGSSVF---------YAMFYGD------LAEVKSEIHIPD-- 185

  Fly   248 IYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQL-- 310
                      :..|..|.:.|.::..:   :..:..||:.|              ..||.|.:  
Mouse   186 ----------VEPAAFLVLLKYMYSDE---IDLEADTVLAT--------------LYAAKKYIVP 223

  Fly   311 AAAKASQS-TENGAEGDGA-----QQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEI 369
            |.|||..: .|...|...|     |..|...|.          |.....::||..||:.|.....
Mouse   224 ALAKACVNFLETSLEAKNACVLLSQSRLFEEPE----------LTQRCWEVIDAQAEMALRSEGF 278

  Fly   370 SDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRM 434
            .::..:.||.:|.|:.|..: |..:||.:..|:.|||.|:.:..||.|:|.|||......|...|
Mouse   279 CEIDRQTLEIIVTREALNTK-EAVVFEAVLNWAEAECKRQGLPVTPHNKRHVLGRALYLVRIPTM 342

  Fly   435 TASEFRRCCERLELL 449
            |..||.....:.::|
Mouse   343 TLEEFANGAAQSDIL 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 10/65 (15%)
BACK <354..423 CDD:355779 23/68 (34%)
Btbd6NP_964008.2 BTB 130..233 CDD:279045 26/147 (18%)
BTB 138..237 CDD:197585 25/142 (18%)
BACK 243..349 CDD:197943 34/116 (29%)
PHR 394..537 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45774
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.