DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and CG11714

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001027123.1 Gene:CG11714 / 3772566 FlyBaseID:FBgn0036170 Length:383 Species:Drosophila melanogaster


Alignment Length:362 Identity:65/362 - (17%)
Similarity:120/362 - (33%) Gaps:126/362 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 PAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDD----------RYMIRCERK--- 174
            |..:.|.:.|.......|:||.:|....|:.          |:          :.:..|...   
  Fly     5 PIRTLPNSKMRSCMMELGRTNRHTDCTFIIE----------DESGGSQSFPCHKLLFSCASDVFD 59

  Fly   175 -----SVLERSVELAKLIHAGPNSGRKSDNH---FQILNVDKNDFELIVRYME---KHFIPYR-- 226
                 ..:|.:..:.:|....|:...|..::   ::...:.|.||:.::|..|   |:.:...  
  Fly    60 RMLYGDYIESTSGVVRLNDVQPDIFEKFRDYVYGYECDKLQKYDFDTLIRLCEFANKYLVQSLEE 124

  Fly   227 -------------DHKHLLKILELSDRFNVPDLI-------------------IY---C------ 250
                         |...||::.:.:.|.|...||                   :|   |      
  Fly   125 DCVKDLLIRKNTFDMGELLRLFQCAHRMNRKSLINQIAWELKCTFKSTLDHSGVYEFNCEVFKHY 189

  Fly   251 IRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKA 315
            |..:..:||.|....:.:....|.|          |...|:..|:..:.||:|..         .
  Fly   190 IEVIASKISEADRFRLLEMYLKYNG----------IEELESAGQVDSQDATEANT---------T 235

  Fly   316 SQSTENGAEGDGAQQNLIPNPN--PFTTE-DYGV-----ALLHNTLQLIDMHAELQLSMPEISD- 371
            :.:|.|..|.   |::.:|:.:  |..|| .:.|     :.:.:.|.|||..   :||..|..| 
  Fly   236 TITTTNEVEN---QESELPSTSCVPLKTECSFAVPNKKASFVSDLLALIDFG---KLSPKEFYDG 294

  Fly   372 ----------LRFEELETLVK-----RDTLQLRSEVT 393
                      .::|.:..:.|     :|.|||:..:|
  Fly   295 PGKSNFLSLAEKYEHMYQIAKNCVTAKDELQLKMALT 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 17/114 (15%)
BACK <354..423 CDD:355779 14/56 (25%)
CG11714NP_001027123.1 BTB 27..131 CDD:279045 14/113 (12%)
BTB 29..133 CDD:197585 13/113 (12%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.