DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and CG17068

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_608379.1 Gene:CG17068 / 33024 FlyBaseID:FBgn0031098 Length:694 Species:Drosophila melanogaster


Alignment Length:196 Identity:33/196 - (16%)
Similarity:60/196 - (30%) Gaps:70/196 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 ILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSDRFNVPDLIIYCIRELDLRISSATALDIF 267
            |.:|....||.::.|:....|.........::..::.::.:|.::..|..               
  Fly    72 IPDVQPEAFEAMLEYIYTDRITIGSFDKACELCYVAKKYMLPHVVTRCTH--------------- 121

  Fly   268 KALWFYQGIALTNQHQTVITTQETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGDGAQQNL 332
             .||                     ..|:.|.|.:|...||                       |
  Fly   122 -FLW---------------------ADLSPKNACRAYEFAK-----------------------L 141

  Fly   333 IPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFEC 397
            ...|.          |:.:::.||..:....||.|...|:....|..::.::.|.:.||:.||.|
  Fly   142 FDEPR----------LMQSSMDLIAANTREVLSDPSFLDIEVSTLMAILDQNRLNIDSELDLFNC 196

  Fly   398 L 398
            |
  Fly   197 L 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 8/54 (15%)
BACK <354..423 CDD:355779 14/45 (31%)
CG17068NP_608379.1 BTB 19..123 CDD:279045 8/66 (12%)
BTB 27..127 CDD:197585 10/91 (11%)
BACK 136..>199 CDD:197943 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.