DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and Btbd3

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001101252.1 Gene:Btbd3 / 311462 RGDID:1311623 Length:528 Species:Rattus norvegicus


Alignment Length:284 Identity:68/284 - (23%)
Similarity:109/284 - (38%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 ERKSVLERSVELAKLIH--AGPNSG-RKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLK 233
            ||.:|:..: :|...:|  .||..| ::...|..:|.|..:.|         |.:.|.:      
  Rat   114 ERNAVMFNN-DLMADVHFVVGPPGGTQRLPGHKYVLAVGSSVF---------HAMFYGE------ 162

  Fly   234 ILELSDRFNVPDL----------IIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITT 288
            :.|..|...:||:          .||| .|:||      |.|                  ||:.|
  Rat   163 LAEDKDEIRIPDVEPAAFLAMLKYIYC-DEIDL------AAD------------------TVLAT 202

  Fly   289 QETGQQLARKKATKAKAAAKQLAAAKASQSTENGAEGDGAQQN---LIPNPNPFTTEDYGVALLH 350
                           ..|||:......:::..|..|...:.:|   |:.....|...|    |..
  Rat   203 ---------------LYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQSCLFEEPD----LTQ 248

  Fly   351 NTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATP 415
            ...::||..|||.|......|:.|:.||::::|:||..: |:.:||....|:..||.|:.:..:.
  Rat   249 RCWEVIDAQAELALKSEGFCDIDFQTLESILRRETLNAK-EIVVFEAALNWAEVECQRQDLALSI 312

  Fly   416 ENRRTVLGPLCLTPRYLRMTASEF 439
            ||:|.|||......|...|...:|
  Rat   313 ENKRKVLGKALYLIRIPTMALDDF 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 17/76 (22%)
BACK <354..423 CDD:355779 24/68 (35%)
Btbd3NP_001101252.1 BTB 119..222 CDD:279045 30/158 (19%)
BTB 127..226 CDD:197585 30/153 (20%)
BACK 232..338 CDD:197943 33/110 (30%)
PHR 383..526 CDD:285277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45774
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.