DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and BTBD3

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001381934.1 Gene:BTBD3 / 22903 HGNCID:15854 Length:522 Species:Homo sapiens


Alignment Length:408 Identity:84/408 - (20%)
Similarity:134/408 - (32%) Gaps:153/408 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 KEKRITK--FPLVGALVHKALRRREEAEDEKVQITGPEDNQHQQNNNNNDWEPNRMVLPFGLGPD 112
            |:|::..  ||           |::.|......:    ...||||.:||:               
Human    58 KKKKMAADIFP-----------RKKPANSSSTSV----QQYHQQNLSNNN--------------- 92

  Fly   113 GHHVDAIQSAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDRYMIRCERKSVL 177
                    ..|||                                    |....|....||.:::
Human    93 --------LIPAP------------------------------------NWQGLYPTIRERNAMM 113

  Fly   178 ERSVELAKLIH--AGPNSG-RKSDNHFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLKILELSD 239
            ..: :|...:|  .||..| ::...|..:|.|..:.|         |.:.|.:      :.|..|
Human   114 FNN-DLMADVHFVVGPPGGTQRLPGHKYVLAVGSSVF---------HAMFYGE------LAEDKD 162

  Fly   240 RFNVPDL----------IIYCIRELDLRISSATALDIFKALWFYQGIALTNQHQTVITTQETGQQ 294
            ...:||:          .||| .|:||      |.|                  ||:.|      
Human   163 EIRIPDVEPAAFLAMLKYIYC-DEIDL------AAD------------------TVLAT------ 196

  Fly   295 LARKKATKAKAAAKQLAAAKASQSTENGAEGDGAQQN---LIPNPNPFTTEDYGVALLHNTLQLI 356
                     ..|||:......:::..|..|...:.:|   |:.....|...|    |.....::|
Human   197 ---------LYAAKKYIVPHLARACVNFLETSLSAKNACVLLSQSCLFEEPD----LTQRCWEVI 248

  Fly   357 DMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVTLFECLATWSLAECARKHIDATPENRRTV 421
            |..|||.|......|:.|:.||::::|:||..: |:.:||....|:..||.|:.:..:.||:|.|
Human   249 DAQAELALKSEGFCDIDFQTLESILRRETLNAK-EIVVFEAALNWAEVECQRQDLALSIENKRKV 312

  Fly   422 LGPLCLTPRYLRMTASEF 439
            ||......|...|...:|
Human   313 LGKALYLIRIPTMALDDF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 17/76 (22%)
BACK <354..423 CDD:355779 24/68 (35%)
BTBD3NP_001381934.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 25..44
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR45774
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.