DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and Btbd2

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001366013.1 Gene:Btbd2 / 208198 MGIID:1933831 Length:514 Species:Mus musculus


Alignment Length:431 Identity:99/431 - (22%)
Similarity:146/431 - (33%) Gaps:148/431 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 LGPDGHHV----DAIQSAPAPSAPPAHMMPPAYARGQTNIYTGVPIIVNPYIDFIVVNGDDR--- 166
            |||..:..    :|...||.|..||:   ||.                .|..|...| ||:|   
Mouse    22 LGPSANAAAAPSNAAACAPVPPPPPS---PPP----------------GPGTDAQAV-GDERDDA 66

  Fly   167 ----------YMIRCERKSVLERSVELAKLIHAGPNSGRKSDNHFQILNVDKNDFELIVRYMEKH 221
                      |..:..:.:|.||...|.       |:....|.||           |:.:.:...
Mouse    67 GPGALLREPVYNWQATKPTVQERFAFLF-------NNEVLCDVHF-----------LVGKGLSSQ 113

  Fly   222 FIPYRDHKHLLKI-------------LELSDRFNVPDLIIYCIRELDLRISSATALDIFKALWFY 273
            .:|  .|:.:|.:             ...|....:||            :..|..|.:.|.|:  
Mouse   114 RVP--AHRFVLAVGSAVFDAMFNGGMATTSTEIELPD------------VEPAAFLALLKFLY-- 162

  Fly   274 QGIALTNQHQ----TVITTQETGQQLARKKATKAKAA------AKQLAAAKASQSTENGAEGDGA 328
                 :::.|    ||:||..|    |:|.|..|..|      .|.|.|..|....        .
Mouse   163 -----SDEVQIGPETVMTTLYT----AKKYAVPALEAHCVEFLKKHLRADNAFMLL--------T 210

  Fly   329 QQNLIPNPNPFTTEDYGVALLHNTLQLIDMHAELQLSMPEISDLRFEELETLVKRDTLQLRSEVT 393
            |..|...|.          |....|:.||.:....::....:|:..:.|..:::||||.:| ||.
Mouse   211 QARLFDEPQ----------LASLCLESIDKNTADAIAAEGFTDIDLDTLVAVLERDTLGIR-EVR 264

  Fly   394 LFECLATWSLAECARKHIDATPENRRTVLGPLCLTPRYLRMTASEFRRCCERLELLP--PTEISL 456
            ||..:..||.|||.|:.:..||||:|.|||......|:..||..||.....    ||  |.:..:
Mouse   265 LFNAVVRWSEAECQRQQLQVTPENKRKVLGKALSLIRFPLMTIEEFAAASP----LPAGPAQSGI 325

  Fly   457 ITDALDGKKLKNLTDQQAELLEKF------RQPRAEYARMP 491
            :.|              .|::..|      .:||.|:...|
Mouse   326 LVD--------------REVVSLFLHFTVNPKPRVEFIDRP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 11/78 (14%)
BACK <354..423 CDD:355779 25/68 (37%)
Btbd2NP_001366013.1 BTB_POZ_BTBD1_2 78..204 CDD:349590 33/168 (20%)
BACK_BTBD2 200..305 CDD:350598 36/123 (29%)
PHR 364..513 CDD:400388
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.