DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and CG43120

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:NP_001246754.1 Gene:CG43120 / 12798252 FlyBaseID:FBgn0262580 Length:286 Species:Drosophila melanogaster


Alignment Length:99 Identity:19/99 - (19%)
Similarity:37/99 - (37%) Gaps:34/99 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PIIVNPYIDFIVVNGDDRY----------MIRCERK----SVLERSVELAKLIHAGPNSGRKSDN 199
            |.:...::|||....||::          :::|...    .:.||.:::  |:...|        
  Fly    63 PEVFQIFLDFIYAPNDDQFGNLEPDVLMCLLKCANMWLAVEIEERCIDI--LLDLSP-------- 117

  Fly   200 HFQILNVDKNDFELIVRYMEKHFIPYRDHKHLLK 233
                   |.:...||..:...|.:   |||.|::
  Fly   118 -------DMDPDALIALFAVSHCV---DHKVLME 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 8/42 (19%)
BACK <354..423 CDD:355779
CG43120NP_001246754.1 BTB 12..113 CDD:279045 9/51 (18%)
BTB 21..116 CDD:197585 10/54 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2075
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.