DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment axed and Btbd19

DIOPT Version :9

Sequence 1:NP_001356975.1 Gene:axed / 38741 FlyBaseID:FBgn0035708 Length:582 Species:Drosophila melanogaster
Sequence 2:XP_038967447.1 Gene:Btbd19 / 100361234 RGDID:2320529 Length:399 Species:Rattus norvegicus


Alignment Length:182 Identity:35/182 - (19%)
Similarity:64/182 - (35%) Gaps:71/182 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 PPAYARGQTNIYTGV--PIIVNP-YIDFIVVNGDDRYMI---------RC---ER---------- 173
            |....|||...::..  .:|.|| |.|...|.|.:|..:         ||   :|          
  Rat     4 PGLVVRGQAAPFSTALRSLINNPRYSDICFVVGQERQEVFAHRCLLACRCNFFQRLLGPGIPSPV 68

  Fly   174 ----------KSVLE----RSVELAKLIHAGPN---SGRKSDN-------HFQILNVDKNDFELI 214
                      .:|||    .||:|.:...:.|:   .||::::       .|..||...:     
  Rat    69 VLSTVPAEAFLAVLEFLYTNSVKLHRYSVSLPSRGLGGREAEDARGAGETPFCSLNHSHS----- 128

  Fly   215 VRYMEKHFIPYRDHKHLLKILELSDRFNVPDLIIYC--------IRELDLRI 258
                     |:.|...:|::|..:..:.:.:|..:|        ::.||:.:
  Rat   129 ---------PHPDPVQVLEVLTAAVEYGLEELREFCPQLCLEFVVKVLDVEL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
axedNP_001356975.1 BTB <192..258 CDD:197585 13/83 (16%)
BACK <354..423 CDD:355779
Btbd19XP_038967447.1 BTB_POZ_BTBD19 15..163 CDD:349603 29/161 (18%)
BACK_BTBD19 168..240 CDD:350569 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350760
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.