DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rexo5 and rnt

DIOPT Version :10

Sequence 1:NP_648050.1 Gene:Rexo5 / 38740 FlyBaseID:FBgn0286051 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_416169.1 Gene:rnt / 946159 ECOCYCID:EG11547 Length:215 Species:Escherichia coli


Alignment Length:125 Identity:26/125 - (20%)
Similarity:50/125 - (40%) Gaps:25/125 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 PNNRITDYLTQYSGITAEIMEQVTKRLDVVQKEVSELLPPDAILVGQSLNSDLNAM--------- 448
            ||:.....:::|     |.:.::.|   ||:|.:.......||:|..:.|.|.:.|         
E. coli    82 PNDPDRGAVSEY-----EALHEIFK---VVRKGIKASGCNRAIMVAHNANFDHSFMMAAAERASL 138

  Fly   449 --KMMHPY-VIDTSVCFNTSGVRRRKTKLKDLAKTFLQEIIQENIDGHDSIEDSRATLKL 505
              ...||: ..||:.   .:|:...:|.|....:|...:.  ::...|.::.|:..|..|
E. coli   139 KRNPFHPFATFDTAA---LAGLALGQTVLSKACQTAGMDF--DSTQAHSALYDTERTAVL 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rexo5NP_648050.1 REX1_like 357..507 CDD:99848 26/125 (21%)
rntNP_416169.1 RNaseT 10..209 CDD:188129 26/125 (21%)

Return to query results.
Submit another query.