DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rexo5 and AT3G27970

DIOPT Version :10

Sequence 1:NP_648050.1 Gene:Rexo5 / 38740 FlyBaseID:FBgn0286051 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_189436.2 Gene:AT3G27970 / 822421 AraportID:AT3G27970 Length:357 Species:Arabidopsis thaliana


Alignment Length:173 Identity:43/173 - (24%)
Similarity:78/173 - (45%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   351 TNRSP-MFGVDCEMC--HTEAGCNELTRISIVNENYETVYETLVLPNNRITDYLTQYSGITAEIM 412
            ::||| :..:.|:|.  .::...:...|:.|.:|:...::.|.|.|:..:|.|..:.:||..|.:
plant   129 SSRSPRVVALSCKMVGGGSDGSLDLCARVCITDESDNVIFHTYVKPSMAVTSYRYETTGIRPENL 193

  Fly   413 EQVTKRLDVVQKEVSELL----------PPDA---ILVGQSLNSDLNAMKMMHP--YVIDTSVCF 462
            ..... |..||:::.|.|          |...   ||||..|:.||:.:::.:|  .:.||:...
plant   194 RDAMP-LKQVQRKIQEFLCNGEPMWKIRPRGGKARILVGHGLDHDLDRLQLEYPSSMIRDTAKYP 257

  Fly   463 NTSGVRRRKTKLKDLAKTFLQEIIQENIDGHDSIEDSRATLKL 505
            ......:....||.|.:.:|...:...|  .|..||..||::|
plant   258 PLMKTSKLSNSLKYLTQAYLGYDVHFGI--QDPYEDCVATMRL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rexo5NP_648050.1 REX1_like 357..507 CDD:99848 40/166 (24%)
AT3G27970NP_189436.2 C2H2 Zn finger 17..39 CDD:275371
C2H2 Zn finger 46..63 CDD:275371
REX4_like 136..300 CDD:99847 40/166 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.