DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rexo5 and ISG20

DIOPT Version :10

Sequence 1:NP_648050.1 Gene:Rexo5 / 38740 FlyBaseID:FBgn0286051 Length:681 Species:Drosophila melanogaster
Sequence 2:NP_002192.2 Gene:ISG20 / 3669 HGNCID:6130 Length:181 Species:Homo sapiens


Alignment Length:169 Identity:56/169 - (33%)
Similarity:83/169 - (49%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   359 VDCEMC----HTEAGCNELTRISIVNENYETVYETLVLPNNRITDYLTQYSGITAEIMEQVT--- 416
            :||||.    |.|:|   |.|.|:||.:...:|:..:.|...||||.|:.||:|.:.|...|   
Human    10 MDCEMVGLGPHRESG---LARCSLVNVHGAVLYDKFIRPEGEITDYRTRVSGVTPQHMVGATPFA 71

  Fly   417 -KRLDVVQKEVSELLPPDAILVGQSLNSDLNAMKM-MHPYVI-DTSV------------CFNTSG 466
             .||:::|      |....::||..|..|..|:|. |..|.| |||.            |     
Human    72 VARLEILQ------LLKGKLVVGHDLKHDFQALKEDMSGYTIYDTSTDRLLWREAKLDHC----- 125

  Fly   467 VRRRKTKLKDLAKTFLQEIIQENIDGHDSIEDSRATLKL 505
               |:..|:.|::..|.:.||.::.||.|:||:|||::|
Human   126 ---RRVSLRVLSERLLHKSIQNSLLGHSSVEDARATMEL 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rexo5NP_648050.1 REX1_like 357..507 CDD:99848 56/169 (33%)
ISG20NP_002192.2 DnaQ_like_exo 8..163 CDD:447876 56/169 (33%)

Return to query results.
Submit another query.